PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462853276
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family TALE
Protein Properties Length: 352aa    MW: 37770.8 Da    PI: 6.8853
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462853276genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox27.26.6e-091061431954
                HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
   Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                Fe   ++yp+ +e+  LA+++gL+  qV++WF N R +
  462853276 106 FEHflHPYPKDSEKLMLARQTGLSRGQVSNWFINARVR 143
                664459******************************88 PP

2BELL55.51.5e-181393472
       BELL 34 issFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72
               +ssF+avag g+a+pYt lAl++iSrhFr+L+dai  q+
  462853276  1 MSSFDAVAGAGAARPYTVLALQTISRHFRSLRDAIGAQV 39
               8**********************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF075262.3E-13135IPR006563POX domain
PROSITE profilePS5007112.00184147IPR001356Homeobox domain
CDDcd000861.03E-1287148No hitNo description
SMARTSM003891.7E-987151IPR001356Homeobox domain
SuperFamilySSF466892.1E-1788154IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.1E-2890153IPR009057Homeodomain-like
PfamPF059202.3E-17104143IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 352 aa     Download sequence    Send to blast
MSSFDAVAGA GAARPYTVLA LQTISRHFRS LRDAIGAQVQ SLRRSLGEKD TSAQGGGLSR  60
LRYIDQHLRQ QRAMQQFGMM QQPQHAWRPQ RGLPESAVSV LRAWLFEHFL HPYPKDSEKL  120
MLARQTGLSR GQVSNWFINA RVRLWKPMIE EMYKEEFGAE MDSHSSSENA GNKGKDEAIS  180
SEDHDEFQST SIAAKHGGAG GHQINTFKSE AMGGGMDAGV VGLSGLDGGA MGGAYATSLN  240
LSHHHHHHAP GGNSSLLLQD ALAHHHHHGH GGDARFVSYG DMAGHGLGGY DGGSVSLTLG  300
LQHCNDGGGG GAVPGEQQGL LYGSAGDFEF INGTAEDRQR FGSSQLLHDF VA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrm_A4e-1893151563Homeobox protein Meis2
4xrm_B4e-1893151563Homeobox protein Meis2
5bng_A3e-1893151159Homeobox protein Meis2
5bng_B3e-1893151159Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0680340.0AK068034.1 Oryza sativa Japonica Group cDNA clone:J013131E13, full insert sequence.
GenBankAK1057520.0AK105752.1 Oryza sativa Japonica Group cDNA clone:001-202-C01, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004985591.10.0PREDICTED: BEL1-like homeodomain protein 7
RefseqXP_004985592.10.0PREDICTED: BEL1-like homeodomain protein 7
RefseqXP_004985593.10.0PREDICTED: BEL1-like homeodomain protein 7
RefseqXP_004985594.10.0PREDICTED: BEL1-like homeodomain protein 7
TrEMBLA0A0A9CXM30.0A0A0A9CXM3_ARUDO; Uncharacterized protein
STRINGSi034960m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP90138131
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G16400.12e-84BEL1-like homeodomain 7